DPCstruct | MC55983
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 193 ± 32 aa |
| Standard deviation of domain lengths | 32.28 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 75.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 17.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z4UWD7 | 4-192 | NFQDDLIRRIKQLEQIIEQNLTPRITSIENYLSTLTEKVQTGSVIVTGAFTTEKITPLNISELELIEVYNNVPKVLLKNSIIAELTA… |
| A0A7W0JGH5 | 220-387 | KQLENLAAADSDLFTRLAELSAEISAMNSTVRGLRGASAVAAAMSPAGDGIPLRQPEPPAFPVSADVYLRKMQRYATVVKPDFQNGI… |
| A0A139L0M2 | 80-287 | None |
| A0A2T1C7P8 | 172-400 | None |
| K9Z2B9 | 271-484 | None |
| K9Z3Z9 | 9-188 | None |
| A0A2W7B7U7 | 11-207 | None |
| Q116N3 | 2-152 | None |
| A0A5M6A0Q5 | 10-231 | None |
| A0A832LZN7 | 62-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.