DPCstruct | MC5598
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 123 ± 12 aa |
| Standard deviation of domain lengths | 12.39 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15599 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E7YHC6 | 5-134 | SALRARYDSMIARMGLAPADYPLHFAARHDGGSHIEPLAPDGWRLRVTERGQVLAETRFADDEALLYRLVCDVAAAEGARLHAGQSA… |
| A0A6I6GC33 | 34-164 | QMEITLAEIQVLVDRLAEKINAPFHLLPSYGHTRDGAYPHIEISDKGYHYVVVERGEELERFVTESLNELLFKVFRSVTFSMACDFE… |
| A0A8B4F216 | 3-115 | None |
| A0A1G9DCS8 | 8-132 | None |
| A0A2N3VMQ0 | 6-131 | None |
| A0A1X7JJG0 | 208-333 | None |
| A0A0R0DYR8 | 8-112 | None |
| A0A7X0RI35 | 57-167 | None |
| A0A848XJQ5 | 6-128 | None |
| A0A2P7PRW4 | 5-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.