DPCstruct | MC55978
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 103 ± 7 aa |
| Standard deviation of domain lengths | 6.98 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 74.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 53.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A068VQF8 | 151-260 | KNIADLFPSKEAQEEVRKYEEIKNQAAANLKSVYDEIRPTIEKHERDSQDDVPPSVGTKWVGAHCAKYKADLNFSASVIKNFLNIAQ… |
| A0A7C9ANF0 | 1-109 | KDAVKLLASKEAEQEILTFEEIRKDASSNLEALYDEIRPAIEEHERDTQDSVPTSVAEKWIEASCLKMKTEFDLYFSVVKNLMFSPK… |
| A0A4S8IZF9 | 430-521 | None |
| A0A061FHJ3 | 241-349 | None |
| A0A438JWE9 | 1-92 | None |
| A0A835R7G9 | 259-362 | None |
| Q8L819 | 407-512 | None |
| A0A2P5BV25 | 288-396 | None |
| A0A1U7VVK1 | 88-178 | None |
| A0A5N6RM22 | 395-501 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.