DPCstruct | MC55972
Metacluster Properties and Pfam Annotations
| Number of structural domains | 726 |
|---|---|
| Mean domain length (aa) | 146 ± 26 aa |
| Standard deviation of domain lengths | 25.73 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.64 |
| Pfam Score | 98.79 |
| Assigned Pfam label(s) | CL0023- PF05911- PF16183- PF16540 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L0TE68 | 401-546 | DLAGSERVKKTLATGQQLNEAKDINLSLLELGNVIQALAESKKHIPFRNATLTRLLQESLGGNCLTSLIVCVSPTRKDLSETKGTLL… |
| A0A8A0RQV0 | 3-104 | EKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGSTYVPYRDSKMTRILQDSLGGNCRTTIVICCSPSSYNESETKSTLLFGQRA… |
| A0A7S4RPC1 | 797-926 | None |
| A0A0V0QKF1 | 213-343 | None |
| A0A0K0E7M4 | 297-439 | None |
| A0A1I8I6U1 | 666-809 | None |
| M9M8A7 | 904-1043 | None |
| A0A6S7N794 | 1-101 | None |
| A0A2B4STD0 | 218-367 | None |
| A0A7S4S091 | 893-1022 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.