DPCstruct | MC55971
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 69 ± 6 aa |
| Standard deviation of domain lengths | 6.09 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 43.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L0TDK0 | 56-116 | TGEPCRPSFIDARDAFLLAEQNLTGGVNRCLNWKGFAQRGLGAMAAQGVYVNSDGVPPECE |
| D8PR03 | 180-244 | LFIDSLALQPCNPTMVQSRDAWIQADENRYNGTHKCAVWKAFASRGFGVSAADFNDDETVPEECQ |
| A0A1S8VAF4 | 5-64 | None |
| A0A4Q1EQP3 | 549-631 | None |
| A0A5B1BJ46 | 403-485 | None |
| A0A4V5NCI3 | 182-253 | None |
| G4TCP8 | 51-116 | None |
| A0A7V3UIT9 | 337-413 | None |
| A0A167KCZ3 | 26-94 | None |
| A0A2C6AG94 | 109-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.