DPCstruct | MC5597
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 140 ± 15 aa |
| Standard deviation of domain lengths | 14.77 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 20.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E2IR29 | 20-144 | QPPQVRSLHPVAGRFVYALRLIALHERSHSDPVPELTQRLGRISIAIKTLQLLETVTKAWPETVHVRRFCCGCLSHDELTLGRMLEA… |
| A0A5E7YF34 | 23-160 | PSSSTASRADLIAALARPPRLGDFGMGAAKAVISLRLVALCVQSGHDPIAVLARRLGGVGEAKAMFGFLDRCGAVWPERMAVHRPCC… |
| A0A7W9R3Z9 | 53-187 | None |
| A0A545TEV7 | 199-332 | None |
| A0A844YX45 | 21-164 | None |
| S9QTH8 | 7-126 | None |
| A0A238KEG0 | 1-177 | None |
| A0A1H7C3J5 | 6-132 | None |
| A0A0F7M5B6 | 4-142 | None |
| A0A1Y5SZW3 | 5-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.