DPCstruct | MC55969
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 232 ± 35 aa |
| Standard deviation of domain lengths | 35.49 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.52 |
| Pfam Score | 49.53 |
| Assigned Pfam label(s) | PF03458- PF05197 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H6BGI5 | 2-198 | NTIGLVAFALVGSAKAIREQFDLFGVAVVGLATAFVGGTTRDILVNRVPLALSSLGEISLGLLGVLLAVGLNVVIDSPEEHPVTMLA… |
| A0A0L0TC36 | 67-330 | PSYGELGVKVLENYGGVFVSYVTALHATRVCFGLFSNHHSSVSLLHSWVAMCVLSFGGTTLSAFLLGHPPGWLLSNTTLPIYTAIYL… |
| A0A835Y7L1 | 25-284 | None |
| A0A316YR96 | 72-369 | None |
| A0A5B7F3X5 | 1-209 | None |
| L1K029 | 24-238 | None |
| A0A2P6NP18 | 97-346 | None |
| L8HCX2 | 12-253 | None |
| D8M778 | 1-205 | None |
| U3KHH5 | 199-463 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.