DPCstruct | MC55961
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 291 ± 58 aa |
| Standard deviation of domain lengths | 58.03 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.88 |
| Pfam Score | 72.72 |
| Assigned Pfam label(s) | CL0123- CL0125- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H9G8J9 | 2-224 | LVSLAGPNPQVAKKTHILVPLGSPLSDLSWSAELRDTGTNTMTIRVNTSPEAVIGKYQFSVKTRSKAGEYQAPFDPRYEIYILFNPW… |
| A0A2I0TI72 | 9-318 | YSVESQGADLTPTHISWQPSLNASAHHTDKYANTELTVRRGQGFTISLYFNRPRQNGESLAFVTEIGPSPSESHRTKAVFKLSEAGA… |
| A0A1I8F7F4 | 309-651 | None |
| A0A6A4JYQ3 | 311-613 | None |
| A0A0C2MKW2 | 575-781 | None |
| A0A7R9Q356 | 62-292 | None |
| A0A4Z2GKC5 | 31-345 | None |
| A0A183H7Q4 | 306-573 | None |
| A0A6P8GKT3 | 262-617 | None |
| A0A7M6DR73 | 145-462 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.