DPCstruct | MC55958
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 306 ± 65 aa |
| Standard deviation of domain lengths | 65.41 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 81.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.08 |
| Pfam Score | 75.30 |
| Assigned Pfam label(s) | CL0020- CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0TCY5 | 1-316 | MSNSPSAKEVFKERIGYAHLYEVLRSQGQPTQRLLQELLNMAVEGDHSSFPVRPIRNEQPLLILLAWLPALACRELQVFLSGQLRRL… |
| A0A7C7KUF5 | 2-274 | KPLIALLKERDADVEHVMWILSALKSSHALELLIKLLRDRSAIVRARAVYTLGRLRDAKAVEPLIAALNDKSATVRRMVVLALKEIS… |
| A0A6G0HI09 | 425-906 | None |
| Q19317 | 132-415 | None |
| A0A821HSE9 | 14-274 | None |
| K5VBJ7 | 10-258 | None |
| A0A2G8LA92 | 2-262 | None |
| H0XPV2 | 17-274 | None |
| A2DG77 | 691-958 | None |
| A2FFJ9 | 208-483 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.