DPCstruct | MC55951
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4 |
|---|---|
| Mean domain length (aa) | 168 ± 32 aa |
| Standard deviation of domain lengths | 32.37 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 70.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0178 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A232EXH5 | 595-741 | NRALAVNCNAKINEKDGAEATDWKAGSPIRVVRNFKLAKHSKYAPEDGNRYDGIYKVVKYWPEKGQSGFRVWRYLLRRDDPTPAPWT… |
| A0A0C4EKT5 | 1-200 | MQDNQNPHGPYNSALQMSLRTGHPVRVVRGSQLIASPWAPVSGYRYDGLYKVTRADMVRDPSGVTSFKCVVFRMERVEEAGYGLYEL… |
| A0A2P6MZP5 | 349-474 | None |
| A0A4P9VZS9 | 202-400 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.