DPCstruct | MC55948
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 185 ± 31 aa |
| Standard deviation of domain lengths | 30.94 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 45.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0T1M9 | 5-184 | RGWPMYAQLLIDLFKYLAPFLRNVELTKPMQILYKGTLRVLLVLLHDFPEFLCDYHYGFCDVIPPNCIQLRNLILSAFPRNMRLPDP… |
| A0A6G0IW65 | 138-336 | ISHRIFIARMLAHTPQQKGWPMYAQLLIDLFKYLAPFLRNVELNKPMQILYKGTLRVLLVLLHDFPEFLCDYHYGFCDVIPPNCIQL… |
| A0A7R9PC25 | 438-612 | None |
| A0A5B7CPH8 | 78-255 | None |
| A0A812MGR7 | 48-195 | None |
| A0A4S4DIG3 | 200-348 | None |
| Q7RK48 | 541-735 | None |
| A0A2J6M1L5 | 18-219 | None |
| A0A4D9BLT1 | 4-179 | None |
| B8CC81 | 95-271 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.