DPCstruct | MC55946
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 112 ± 11 aa |
| Standard deviation of domain lengths | 11.11 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 39.26 |
| Pfam Score | 86.11 |
| Assigned Pfam label(s) | CL0597- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0T084 | 1-139 | MLAAANAGADVVDVAVDAMSGMTSQPSMGALVACARGTPLDTGIALERVFEYSEYWEGARGLYAAFDCTATMKSGNADVYENEIPGG… |
| A0A0K2R0P0 | 73-180 | LLAAVDAGVDAVDVASASLAGTTSQPSASALVAALAHTQRDTGLSLDAVSSLEPYWEAVRRVYAPFESGLPGPTGRVYQHEIPGGQL… |
| A0A832U5Z9 | 54-167 | None |
| A0A8B1NAS3 | 215-331 | None |
| A0A3Q9LGD1 | 64-180 | None |
| A0A7E4RXI9 | 112-226 | None |
| A0A512UKP3 | 3-101 | None |
| H7EK57 | 143-251 | None |
| A0A4R1Q070 | 36-149 | None |
| A0A379V0J0 | 1-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.