DPCstruct | MC55940
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 205 ± 36 aa |
| Standard deviation of domain lengths | 35.82 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.03 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | PF02580- PF07281 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6U4ACX8 | 14-241 | GRQIISMHRAGSADAADDGGDPSSVVKLSKQLPAWMLQFTAMASAGALLGSLSDALCHGRYEVLHYTPADLSFFGLSSARWVPPLFA… |
| A0A7Y4ZS65 | 10-184 | AAALLALVGFTLGPVYDSIHTYSGATWYPAPQLLRNVWWCPPLFAAAAVAIGMPRLLQDTRIYRDPRPPGNRALAGAFGIFTAAYLA… |
| A0A6U3VB03 | 79-324 | None |
| A0A812QHN9 | 27-260 | None |
| A0A507FEW8 | 72-273 | None |
| A0A7S4AMB6 | 162-405 | None |
| A0A2T0FLB2 | 37-262 | None |
| M8BSY7 | 48-210 | None |
| A0A6A5DJZ8 | 26-219 | None |
| A0A1E3QMG4 | 1-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.