DPCstruct | MC5594
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 61 ± 4 aa |
| Standard deviation of domain lengths | 4.12 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 46.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T0PBL3 | 1-52 | MAPFGRDLELAVIEGNAIHKLVFPCRRIPGGWVKAETAERILVQPTHWRAWI |
| A0A442GSS3 | 8-69 | AMWKPILTAPYFCMLELAVINEDGEHRLVFPCRRVVDGWQDARSGRQVEVCPTHWREWMMSE |
| A0A7S7UVA9 | 1-64 | None |
| A0A2U3Q915 | 177-234 | None |
| A0A7R6Y3Z7 | 52-111 | None |
| A0A7W5LKN2 | 44-109 | None |
| Q218S9 | 2-61 | None |
| A0A7Y6VYY7 | 2-66 | None |
| A0A7Y6SSP3 | 17-75 | None |
| A0A3M9X3L5 | 1-60 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.