DPCstruct | MC55939
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 349 ± 49 aa |
| Standard deviation of domain lengths | 49.16 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 73.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04024 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E1DY64 | 1-398 | MKKTLTINIGHSIFNIEEDAYEILNKYLDSIKNYFKKIDNDSEIIKDFELRIAENFSAKVSPIKQCIDLSDVKEVIKIMGSLDDFKE… |
| A0A4R2GLD6 | 1-312 | MKRTISINIASTAFFIDEDAYGRLNDYLRKLESWFSGKDGGQEIINDIENRFRELFLERINPKTGVITLSMVDEVIAIMGQPEDFIP… |
| A0A3N2M8Z2 | 1-345 | None |
| A0A1I1KFH9 | 1-438 | None |
| A0A1F5TPU8 | 1-362 | None |
| A0A136L7B7 | 1-348 | None |
| L1PSN6 | 1-263 | None |
| A0A136MT45 | 130-482 | None |
| A0A7J6Z793 | 1-326 | None |
| A0A839JV38 | 2-409 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.