DPCstruct | MC5593
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 119 ± 12 aa |
| Standard deviation of domain lengths | 11.74 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 41.62 |
| Pfam Score | 96.15 |
| Assigned Pfam label(s) | PF14931- PF00173 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F9CIC9 | 1-103 | MAKDPLGEAGLHFDELNKLRVLEPEKVVGGLIELVDELAKEAETEKMKAIGARNLLKSVAKQREAQQQQLHALIAEKTMQLERYRIE… |
| A0A5N3X1L2 | 48-178 | MAKDILAEAGLHFDELNKLRVLDPEVTQQTIELKEECKAFVDKIGQFQKIVGGLIELVDQLAKEAENEKMKAIGARNLLKSIAKQRE… |
| T1JZV6 | 1-128 | None |
| A0A7R9QTV5 | 380-497 | None |
| A0A820ZF22 | 2-131 | None |
| A0A7R9KSN0 | 316-444 | None |
| A0A2T7PDD8 | 3-115 | None |
| A0A452UXH7 | 2-132 | None |
| A0A3S3QQ28 | 2-128 | None |
| A0A336MV07 | 1-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.