DPCstruct | MC55927
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 85 ± 4 aa |
| Standard deviation of domain lengths | 4.46 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 36.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10973 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G6JAW0 | 2-89 | RKLFICLLVLAGSGCASLSREECVTGDWYGIGYRDGIQGQVESHVSGHQEACSAYQIKLDLDDYIRGREQGLKIYCKPDNGYRQGVVE |
| A0A2X1B7D6 | 15-94 | ALLSSCTTMSKDECLAGAWGEKGYVDGSSGYPMTRLDDHTKACAKFQIAPNPAAYGSAREDGLRTYCTFRRGWEEGRAGN |
| A0A536YCY8 | 7-87 | None |
| A0A1W9I4D0 | 1-87 | None |
| K2JN45 | 1-84 | None |
| A0A511QCM2 | 1-83 | None |
| A0A2M7Q1E9 | 5-96 | None |
| A0A0D0QCZ7 | 5-81 | None |
| A0A853IIE9 | 18-107 | None |
| A0A318EC57 | 44-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.