DPCstruct | MC55923
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 191 ± 25 aa |
| Standard deviation of domain lengths | 24.88 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A210Q406 | 1-211 | MASIFRRRNKTYTLKEFYESNVTLPVIIYIDQGFAGNNAVETIGAGQYFFIHAVYRQRRAMTRGNIPAVSADKCLISIPLSYPIKFR… |
| A0A6J8BQF5 | 381-595 | SAFEYSEEKQLTLPEFHRKYKDNLPLLVIVTKGFHGETMYDDYANGQIIRLNRACQQLRALARLSRDAGSIRDEFLSIPVYGKYKFA… |
| A0A2T7PFT4 | 406-580 | None |
| A0A2T7PG48 | 1-174 | None |
| A0A2T7PFT5 | 15-239 | None |
| A0A8B6DQG5 | 17-160 | None |
| A0A7M7STR1 | 9-209 | None |
| A0A3B3RI43 | 6-208 | None |
| A0A6P4ZTJ3 | 1-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.