DPCstruct | MC55922
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 118 ± 13 aa |
| Standard deviation of domain lengths | 13.30 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 70.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A210Q3F1 | 3-120 | HSSGVLPPSHFGQTIPPDIRGQFDNSQFGYLECEDSDKAATGDHVLVPDRGSTNSTNKPCVYCKLRGVKTTTGLPIKSYWKCNACNL… |
| A0A6J8DPL9 | 47-154 | SAGILGQQTRSSVDDLATLRPPRNLPMDSMFTSTCSASCSGGGHIPVNMMGVRKGCVYCQLTKSKTRSGYWVYTRYKCGECAVPLCM… |
| A0A210Q3J1 | 3-90 | None |
| A0A210Q3I9 | 1-140 | None |
| A0A210Q3E7 | 2-116 | None |
| A0A8B6F776 | 436-562 | None |
| A0A6J8DM63 | 168-292 | None |
| K1R6Q1 | 58-172 | None |
| A0A0M9A714 | 15-143 | None |
| K1PRT1 | 122-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.