DPCstruct | MC5592
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 65 ± 3 aa |
| Standard deviation of domain lengths | 2.89 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 85.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.75 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 74.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R3CMG0 | 92-150 | EPPPPEYAAIPPGAFDPRELTDFQLDELVHRIIGRITRLIRTELRLDRERIGKLRDPRR |
| A0A1A9J7N1 | 1-61 | MSQPAPPEYSGVPAGAFDPRELTDFQLDELVHRIIGRITRLIRTELRMDRERIGRLRDPRH |
| A0A0K2AU34 | 377-439 | None |
| A0A7K3EMV6 | 85-146 | None |
| A0A7W9PY07 | 207-272 | None |
| D6K2M5 | 165-229 | None |
| A0A3N4S9Y2 | 120-186 | None |
| A0A2P8Q673 | 301-366 | None |
| A0A3N4UMA3 | 1-66 | None |
| A0A101SXP0 | 172-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.