DPCstruct | MC5591
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 150 ± 29 aa |
| Standard deviation of domain lengths | 28.85 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 29.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01337 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D9CCU4 | 6-126 | EITKKSIWKTFKKDELQGWLVCALNNSNNNTPKTNITIQIDGNEFHNLDSFLCTLGEEIHGPGGYFGRNLASLYDCLRGDFGVESVS… |
| A0A1A9J2W2 | 18-179 | SPVPPDPSSGAGERPGADWDFLGHTCEYPDAGRIWPLWAEGGPAGPGEWARRPARTHGSWLHVVQTAWFTSGRRATRYGTTETAVLD… |
| A0A367ES20 | 57-233 | None |
| N9EBQ0 | 17-155 | None |
| A0A1M6B601 | 243-368 | None |
| A0A172ZIC0 | 95-255 | None |
| K0KA49 | 24-154 | None |
| A0A1I6FH88 | 184-328 | None |
| A0A544Y2V5 | 32-201 | None |
| A0A7U0HVF5 | 4-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.