DPCstruct | MC55902
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 314 ± 83 aa |
| Standard deviation of domain lengths | 83.28 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 79.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 16.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X6USA6 | 3-330 | KDTILYLMERGMISQSLQDYETSSQDWRKAVDKDELLETYSVSQGAASLLANDLVLSFRGEPFERTLLFAFLAKNYLAQHNWDYAAI… |
| A0A7Y2B4H9 | 103-432 | DEVGSFLVNDYRKEYRAEDFEAALIHPIKAINYLLLNDREAALVECRAANIFLTELQEKYEHKNAYSESGFARYLSGIIYESEGKLD… |
| A0A7W1EM27 | 2-219 | None |
| B8FHW0 | 367-637 | None |
| A0A846ZYT7 | 212-541 | None |
| A0A7X7M1V4 | 43-475 | None |
| A0A7Y5VQK8 | 117-519 | None |
| A0A2N1S1M2 | 33-449 | None |
| A0A7C4J1C3 | 26-464 | None |
| A0A7X8WBV3 | 7-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.