DPCstruct | MC5590
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 152 ± 11 aa |
| Standard deviation of domain lengths | 11.45 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y6L5Q7 | 388-528 | ELFPAPPRDWGRLDEAELPTLTAKAESVMADFVTYIEQRGWTVAQMGGSTRTLRILVAHLGADAPIREKDVRSVASLSSNHQGARVV… |
| A0A193KXJ9 | 1-161 | MVPGQERLFELRRDWSPVVELSRLDLPTLMESAERLLADLDSVMQREMGFKFTATKTRRTLAVLVSWLGADAPLLESDIRALVDNRP… |
| A0A7W7UYZ3 | 1-152 | None |
| A0A1Y5KNZ4 | 1-145 | None |
| A0A0Q8NGQ3 | 312-466 | None |
| A0A2R4TD97 | 289-451 | None |
| A0A6A0ASJ5 | 370-524 | None |
| A0A3R9WAI8 | 107-248 | None |
| A0A5N8X9A0 | 301-437 | None |
| A0A4R7GV37 | 78-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.