DPCstruct | MC559
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 92 ± 6 aa |
| Standard deviation of domain lengths | 6.45 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A327MBI3 | 13-104 | ERHLPAWLGQRLIGRQGRFGLLLTTGDVLRITTIAAAHLSAEGLVLLDVQLDAAGVPDGVDLAWRSKHFLGMPVPGALAATVNLAQV… |
| A0A4P7C0A9 | 14-114 | IAKAEELLPAWFIERMMNDTWFFGVLLDTGQMLGIEHINKVRQAANGDVWIDVEMLEHRQFRVEYLPDSWKGVNLLCSPTSRTDTSI… |
| A0A845Z4A3 | 56-143 | None |
| A0A4R2N4E5 | 1-78 | None |
| A0A0D7KE28 | 12-99 | None |
| A0A1G6LBI7 | 17-112 | None |
| A0A109LQ53 | 40-138 | None |
| B2IV19 | 12-99 | None |
| A0A1H5WX62 | 68-160 | None |
| A0A3L7NQV0 | 19-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.