DPCstruct | MC55889
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 76 ± 8 aa |
| Standard deviation of domain lengths | 8.13 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 39.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0243 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A535G9I7 | 4-74 | IDGHDITLTNPDKVLFPDDGITKGDLVEYYRGIADRMLPQVRDRPLHMNRYPDGIGGIAIQQKRVPDSFPA |
| A0A1E7N6Q5 | 1-75 | MPQMTVDGRTLALSHLDKVYYPRVGTLKGDVLRYYAAVHTVLLPHLRDRPVSFLRCPDGVEAEVFVAKNPPPGTP |
| A0A534NDN4 | 384-448 | None |
| A0A538KTD2 | 521-597 | None |
| A0A1I5BHE5 | 350-421 | None |
| A0A2V7JND6 | 173-238 | None |
| A0A0M3CL67 | 57-138 | None |
| L7VKD1 | 1-70 | None |
| A0A534TSH9 | 306-382 | None |
| A0A158C035 | 143-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.