DPCstruct | MC55888
Metacluster Properties and Pfam Annotations
| Number of structural domains | 378 |
|---|---|
| Mean domain length (aa) | 114 ± 19 aa |
| Standard deviation of domain lengths | 19.38 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.37 |
| Pfam Score | 98.16 |
| Assigned Pfam label(s) | CL0113- PF01556- CL0123- PF00684- PF01025 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4T0R322 | 217-341 | RIRLQGEGDEVPGAKPASLVFRLRTKKHDTFRVSGYDLAINIKLTLLEALSGFEKIICHHLDGRTVKVSVPQGRVIQPNETLCLRDQ… |
| A3IPY9 | 1-80 | MPVTPSEAILGGSVEVPTIDGLVKMTVPKGVRPGQRLRLANKGYPDASGKRGDQLVEIQIAIPSEVSDEEIALYQQIREK |
| A0A1Q6Z1I9 | 67-146 | None |
| A0A654HC41 | 37-163 | None |
| A0A6U5GHA0 | 40-169 | None |
| A0A1B0C5J2 | 2-76 | None |
| A0A2G8LNX5 | 13-126 | None |
| A0A6D2I0V1 | 628-745 | None |
| B0EIW1 | 32-171 | None |
| A0A1B0C165 | 221-344 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.