DPCstruct | MC55884
Metacluster Properties and Pfam Annotations
| Number of structural domains | 238 |
|---|---|
| Mean domain length (aa) | 172 ± 37 aa |
| Standard deviation of domain lengths | 36.82 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 72.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.25 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.72 |
| Pfam Score | 97.75 |
| Assigned Pfam label(s) | CL0213- CL0126- CL0056- CL0692- CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7E6EN23 | 18-202 | EEEKVNCDDNNYLCPIWAKVGHCRINAAFMLKNCKKSCSQCTSGGKEEEKVDIGEVKCDDNNYLCPIWAKVGHCRINAAFMLKNCKK… |
| A0A7S2INK2 | 13-130 | SRCKDEREECPRWLAAGECESNAQFMFKYCAESCGVCTTQNGCIDQNQNQTQCKLWKSYGECENNAPFMLSQCSATCGLCKSVCSDQ… |
| A0A0N5CJE8 | 61-262 | None |
| A0A2L0VDJ5 | 696-849 | None |
| A0A7M5TYX2 | 87-257 | None |
| A0A7M5TW96 | 70-273 | None |
| A0A6P8I2C9 | 467-646 | None |
| A0A3S0ZKC4 | 7-245 | None |
| A0A0N5CTY8 | 16-156 | None |
| A0A6P8HRX5 | 26-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.