DPCstruct | MC55883
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 71 ± 4 aa |
| Standard deviation of domain lengths | 4.12 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 75.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7E6EH39 | 11-79 | RKKRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKVLHQKGLNGYIILTNT |
| G9JWI7 | 27-88 | ARKRRRGLIEKKRRDRINRCLVELRRLVPTALEKEGSSKLEKAEILHLTVEHLKWLRSTSGQ |
| A0A1I8N548 | 65-137 | None |
| A0A813MHB0 | 31-101 | None |
| A0A068YHA2 | 25-89 | None |
| A0A7I8VG45 | 37-112 | None |
| A0A7R9AWE4 | 187-253 | None |
| A0A1A7ZQF1 | 24-95 | None |
| A0A0P7XS70 | 79-151 | None |
| A0A6P5KAY7 | 28-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.