DPCstruct | MC55881
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 163 ± 16 aa |
| Standard deviation of domain lengths | 16.29 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 51.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0357 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P7U590 | 1-139 | MFQIGRSPGETNDIVMEDNLTVSRFACRLLVSRDPPHTTKLYAGGFNDEHFLTLNQSFQRLGSWDGFTTNGVFIRHAGPAQEWKEVS… |
| K1PZU3 | 453-606 | FQIGRSSEPPIDFVVMDTIPGNLRSMNEGITQSTISRFACRILVDRNPPYTARIYAAGFDSGKNIFLGEKAVKWYVGEEIDGLTTNG… |
| A0A669CNP2 | 225-380 | None |
| A0A2P8XWN7 | 9-148 | None |
| A0A834XKW6 | 209-363 | None |
| A0A6S8UDS2 | 132-295 | None |
| A0A7S4E7U7 | 132-295 | None |
| A0A6J0C7B9 | 169-334 | None |
| A0A673H6T5 | 44-185 | None |
| A0A7R9DNA8 | 2-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.