DPCstruct | MC5588
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 330 ± 43 aa |
| Standard deviation of domain lengths | 42.81 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 13.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N4SEE8 | 1-326 | MFIQYLNPEVLACYGMSYQSIRSQQILRCSLQITRLAVLLTDASLVFPASYIFEVPHFSDFLREISPLMASGAITCVAPVIDLEEYR… |
| K9ZRB2 | 45-415 | HTAFIDQARDIHPSKGIGVSRIRKNIFLDVFDPDSRLTLGISKDLNAREHYGLLAKTLNVSVFLCDDFVILPPAFLLECPLVFKLLK… |
| A0A413BCL4 | 2-279 | None |
| C6WDE1 | 3-348 | None |
| A0A3A9FS68 | 1-396 | None |
| A0A3A9A2J6 | 11-407 | None |
| M1NB72 | 2-348 | None |
| A0A150TAH3 | 1-334 | None |
| A0A0D6ADQ0 | 5-357 | None |
| A0A1C5G547 | 14-325 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.