DPCstruct | MC55878
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 199 ± 37 aa |
| Standard deviation of domain lengths | 36.76 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0128 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H0VG75 | 3-183 | EQSLISSEKWLQRHGLKANKLSLRQILSQIGFPHCEDYVTSLGRPVASRYADGLFPRFCRAEDGRVYNLTANSELIHQLVEHLAQAV… |
| A0A6P7U0K7 | 50-254 | MLKSSNGKNITTNQTDKSKFDEFYQMNMIQITQDLLNSEKSNNVPPEAREQISADKWIHKYGLVNNKLSWDFILKKIGFKKSEEYVY… |
| A0A835NWE4 | 44-236 | None |
| A0A835NYQ7 | 4-201 | None |
| G1SW02 | 84-258 | None |
| B7Z7Q7 | 213-427 | None |
| A0A822DDI4 | 1-198 | None |
| A0A6P8H7T7 | 81-283 | None |
| A0A819Z5C2 | 19-224 | None |
| A0A183MWA7 | 445-624 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.