DPCstruct | MC55877
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 199 ± 14 aa |
| Standard deviation of domain lengths | 14.21 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 31.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3RN24 | 3-196 | LDILRNEVLPELRIHEFFQVDIEKLVADFEKYVKGIKFKIIQTVQFLIGGPSPEVRDEVLESEPGPYWNRFGFIVNMDRANKIFNRM… |
| A0A0N4T450 | 286-468 | LDILRNEILPQLRVHEFFQVDIEKMVTEFEKYVEEGASPEVRDEMLESKPGLNWNRFGFIVDMNHANMIFNRERNDACDEKDRQWKC… |
| A0A182T4T2 | 300-504 | None |
| A0A3P8AVF1 | 271-501 | None |
| A0A443QM95 | 245-458 | None |
| A0A811KD39 | 268-453 | None |
| A0A0T6B546 | 287-478 | None |
| A0A2A4JG90 | 191-375 | None |
| A0A1B0DM07 | 295-497 | None |
| A0A2H1C542 | 71-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.