DPCstruct | MC55876
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 169 ± 30 aa |
| Standard deviation of domain lengths | 29.91 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 67.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12936 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P7TXF2 | 1-167 | MVPEDIIPPPPNRFSYRNVSECDFGLSLEEILNADYKELNQWVSLKKMVQYRTDEEEYNDKKMYEKRRKKHKLKRHIFKSLKGIEQN… |
| A0A0C2J6B9 | 62-202 | EDVIDDLPVRYNYRKVAPNSYGLTPEQILLCDDKELNKWCSIKKVIGYNDEEEEQKMENIYKRRIKHPQLRKRILPSLFSNTCDLYD… |
| A0A3Q0IKL1 | 1-214 | None |
| A0A3P6QZ95 | 155-269 | None |
| W2SIA1 | 829-998 | None |
| A0A6P7U6P2 | 335-508 | None |
| A0A481AS20 | 358-556 | None |
| F2UI18 | 1-150 | None |
| G7YMF0 | 942-1148 | None |
| A0A663F444 | 555-706 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.