DPCstruct | MC55872
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 295 ± 38 aa |
| Standard deviation of domain lengths | 37.91 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P7TKK2 | 4-271 | PVIVHELRTLNEQYKKRVTDKEQATAVYCKGFCTILQKFLDKHNDSYEEYVFSLCIFLCHYAASYGELAVYDSKEKICQQLFRLCIK… |
| A0A6P7EYC2 | 53-347 | SSRDYCRRFCQVVEDYAGRWQVPLPQLQVLQTALCCFTSASASFPDECEHVQYVLSSLALSFFELLLFFGRDEFYEEPLKDILGSFQ… |
| A0A151PG42 | 6-322 | None |
| A0A1S3SMP5 | 13-224 | None |
| A0A673HDW5 | 7-327 | None |
| D3ZJX1 | 16-333 | None |
| A0A7J8KFM2 | 49-364 | None |
| A0A2P8YB69 | 6-319 | None |
| A0A653BUQ7 | 15-316 | None |
| F1R7Q9 | 11-324 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.