DPCstruct | MC55866
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 122 ± 17 aa |
| Standard deviation of domain lengths | 17.20 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.44 |
| Pfam Score | 85.32 |
| Assigned Pfam label(s) | PF03963- PF00460- PF06429 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G2Y6P7 | 59-175 | LMSKVNEIFDILGAGIRAATVRQKTIANNVANSQTPDYRRFDVKFHDLLADAMDNKDADFSELTPEILQPNETIVNSEGNDVNIEME… |
| A0A1E4ENR0 | 61-174 | VQALASYCAHLQLCREAAQRNLANSKTLNTVDGTPYRRQLVTVSPEGRSLLQEDNGDFNWVYDPTHPNAVQDGSHKGYVAMPNVNEE… |
| A0A258GRC0 | 5-126 | None |
| A0A7S9C9X3 | 6-107 | None |
| A0A3D9HQA1 | 2-129 | None |
| A0A2D6LNT2 | 53-201 | None |
| A0A4Q4XEH3 | 59-211 | None |
| A0A6I1J8T5 | 5-115 | None |
| M6KFP5 | 142-239 | None |
| A0A2W5QNL2 | 6-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.