DPCstruct | MC55859
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 166 ± 29 aa |
| Standard deviation of domain lengths | 29.23 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11876 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A521UC17 | 280-444 | DDLLALAVELAQEHPFRCAVGGYLTTFNEWEKPAAFWCIRKWALQHLGLDVQDPDMASWFVGRELPSTNWLTLLGAGLMEERGITAE… |
| A0A2T7VZT9 | 47-204 | AVHGSAGFSVLFEHGSFSGSSGGVATLPALKRFPGLDFSDPNVFQVEAARSDGLHIKSINWLTILSDKIVERLGGRQALEAKLGSSC… |
| A0A7X1XCY0 | 13-195 | None |
| A0A1B9BYH9 | 18-228 | None |
| A0A285LXF2 | 342-530 | None |
| A0A0N8TD81 | 6-124 | None |
| A0A2V3X4R3 | 145-275 | None |
| B1H686 | 3-121 | None |
| A0A855LXK4 | 2-124 | None |
| A0A6L6IPI9 | 354-534 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.