DPCstruct | MC55856
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 110 ± 5 aa |
| Standard deviation of domain lengths | 4.63 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 94.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2L2LBV1 | 2-115 | RDVADAHVLALTNAGDDFQRYIISATTPFSADDCDSLAKDAASVLRQRTPALADAFTQREWALPATIDRIYSPACAAEGLGWTSRFG… |
| A0A0L0NJP2 | 472-580 | NLKVLELAYRRCDIEDIVSAATCAMQRAREIGWAKYIISAPPPFANDAETLAALDRDPAAVFSKAAPGVDEVFARQGWKHLARVDRV… |
| A0A1G8Y0W4 | 618-724 | None |
| A0A1B3N0F6 | 70-181 | None |
| A0A6C0GJS4 | 1-111 | None |
| A0A244BZZ7 | 5-115 | None |
| A0A7Z7BIC3 | 78-187 | None |
| A0A1C3X0F2 | 3-98 | None |
| A0A084QZT6 | 557-668 | None |
| A0A117E2N8 | 193-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.