DPCstruct | MC55850
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 99 ± 12 aa |
| Standard deviation of domain lengths | 11.73 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.81 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | PF00557- CL0356 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2MIB2 | 1-97 | MGDVAIDQGAFGKRLKLLYESWKGNRSSLWEDSGALGVVVGSTSEDLRYLKSISLHLWLFGYELPDTVLVFTEKEVHVLTSQKKANL… |
| A0A498IJ05 | 9-82 | SPAEHRMDIGLGKKHRYDSWGSSDVLAVTTPNSSEDLQYLKSSALNIWLAGYEFPETIMVVMKKQIHFSCSQAS |
| A0A3Q7F6D4 | 367-486 | None |
| A0A6L5CZ69 | 1-93 | None |
| A0A1R3ISC5 | 352-437 | None |
| A0A446LUP3 | 1-95 | None |
| K0S0X4 | 2-93 | None |
| F4RYV2 | 1-114 | None |
| A0A835IXH1 | 2-90 | None |
| A0A7R8Z8S5 | 10-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.