DPCstruct | MC55847
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 162 ± 36 aa |
| Standard deviation of domain lengths | 35.66 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 87.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q6Z7N6 | 2-169 | AKILRASVMRKSEWDKERDAEAWKRTRLQVLKRDNSTCVYCGWTAQRFMQVNHIEAEDNHDLDNLETVCTACHAVLHIGIKSMQGII… |
| A0A2U8I8S8 | 17-201 | KSTPDKLHRQAHENSQHQCEFCGYTSKNNHLHFVDHNPLNHHSDNLTVVDPLCKAWQNLGALDADDGFVVYLPEIRPEDVNHLQRAA… |
| A0A1I2HNV7 | 6-235 | None |
| A0A2T6B903 | 24-187 | None |
| A0A2N2AMQ2 | 4-189 | None |
| A0A3L8C3C1 | 18-155 | None |
| A0A5U9VSM1 | 21-144 | None |
| A0A0D7L8D5 | 5-153 | None |
| A0A1E3LMQ1 | 10-273 | None |
| A0A1J5J5N6 | 2-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.