DPCstruct | MC55842
Metacluster Properties and Pfam Annotations
| Number of structural domains | 95 |
|---|---|
| Mean domain length (aa) | 160 ± 29 aa |
| Standard deviation of domain lengths | 28.70 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M2Q858 | 48-181 | PSELVRQTVPMQKLKPMLFEPLSLEPTPPRMCYGYPVDKKKCMRIARGLKQRVNIVPYTTSIAMYDAMAYMEKQIGHELEIENVWCE… |
| B0DIZ1 | 16-154 | KPKAPKQPRPPLTLGDMGEVPALMNTGDPRSGKRVRLTVLAFPFPPERQDEWADRHKFALDMNQDNRQFQTIMEVRSRLPRTCRLGL… |
| K5WG81 | 56-218 | None |
| A0A369JPK6 | 36-145 | None |
| A0A0H2RS49 | 1-156 | None |
| A0A5K1K7U3 | 219-443 | None |
| A0A5K1K6I8 | 243-482 | None |
| A0A165Z1L5 | 12-150 | None |
| A0A165YIV7 | 69-220 | None |
| A0A0D2PC01 | 1-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.