DPCstruct | MC55841
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 226 ± 21 aa |
| Standard deviation of domain lengths | 20.87 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 16.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M2PSV5 | 29-254 | FQRLALAVQHRSTSKPEDEPVILAITFGLPLRTILDASDHDARLGALLVLLRDVPADVVFAGAWPGERCARAGFRWAPRSLLGFPRI… |
| A0A0W0FRS6 | 102-325 | IGELARFLEWRTTSKAEDEMLAIAGLANVSAAELVNLPPHERMKIFLLRVQKLPLNIIFMSVPKLKDPGFCWAPQTLMQKGGTHMTV… |
| A0A364N7K9 | 304-530 | None |
| A0A2J6PS28 | 26-261 | None |
| A0A4Q9NHW6 | 264-518 | None |
| A0A4Q4YVN7 | 320-560 | None |
| A0A438MUQ9 | 966-1222 | None |
| A0A507BNB4 | 629-884 | None |
| A0A6A5KGS0 | 538-774 | None |
| A0A1M2VXI9 | 626-867 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.