DPCstruct | MC5584
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 103 ± 12 aa |
| Standard deviation of domain lengths | 11.50 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S7EDB8 | 52-160 | IEQPTFDEIMAVWRSPATQAAYAEHVAKLAIPTSVSWRQANLAMLEVGKLADVEALIQGIADPVEKRKAQIEFNSPVYERSSAFLQA… |
| A0A840C9Q2 | 48-146 | PVLVDDDGVPRESYALEDAPIADITRRQLRLWMLSAGHDDAAIRAAIATLDEPERSQALIEYEDASTYQRSHPLFDLIGPAFEMTPA… |
| A0A142X2A4 | 105-204 | None |
| A0A1V0HX45 | 48-146 | None |
| A0A5P2QY44 | 65-176 | None |
| A0A2D9ETZ2 | 39-141 | None |
| A0A6L3T7C2 | 17-130 | None |
| N9L6R1 | 5-89 | None |
| A0A7H8SE74 | 39-149 | None |
| A0A6I1K1P4 | 128-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.