DPCstruct | MC55834
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 107 ± 14 aa |
| Standard deviation of domain lengths | 13.65 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 49.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N7V0J5 | 1-89 | MVVFSGDLDKAIASFIIATGAASMGKEVTMFFTFWGLNILRDPAIHVSKSGMARLFGWMMPKGADKLHISKMNLAGMGTSMIKRIMK… |
| H1D9F1 | 1-123 | MHAYVSKGNSLTSFENQVIENKEGMTIVVFSGDYDKAMAAFVIANGALAMGKKVTMFFTFWGLSILKKEHSVSVKKSFMDKMFAMCL… |
| A0A1V5PCC0 | 481-596 | None |
| A0A3B8VTE0 | 136-228 | None |
| A0A1V5KM66 | 357-457 | None |
| A0A3D1YZ78 | 1-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.