DPCstruct | MC55833
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 162 ± 25 aa |
| Standard deviation of domain lengths | 25.48 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 93.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05681 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378C7M3 | 41-201 | KVDPQALTLLAQHAFHDASFMLRPAHQQQVADILNDPEASENDKYVALQFLRNSDIAAKGILPTCQDTGTAIIMGKKGQRVWTGGGD… |
| H1D995 | 8-161 | MVTNEVEKMCMAANYYVDPEVLKKINRAYRETEKSPLAKNVLQQILENDAIAEEERVPMCQDTGMAVIFLEIGTEVYIPGDIYEAIQ… |
| A0A654HEF7 | 293-475 | None |
| A0A1J1H7C8 | 117-324 | None |
| A0A6P5WBQ1 | 189-392 | None |
| A0A2G6LX78 | 2-126 | None |
| A0A4R9LS92 | 6-173 | None |
| A0A350M0A9 | 3-168 | None |
| A0A388NRQ0 | 32-212 | None |
| A0A7H1NR15 | 650-873 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.