DPCstruct | MC55825
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 410 ± 62 aa |
| Standard deviation of domain lengths | 62.21 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 64.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.73 |
| Mean length-normalized TM-Score | 0.27 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A653DW03 | 1-358 | MEFDDEPKEICDKLPELNKYQPRFFANSALQQAKVNLTWDETNPDRIEVVEKLSSGKVDDISEGDLQNYLASSSGSEAESEEENDAS… |
| A0A505I0A0 | 91-485 | MEREETEGPPREIFASKKGGDSDDEDEMDSDEEEENIRKSMLKEDKGEEFNSTQLRKYQLERLRYFYAILTFSSRDVAKHVYDLVDG… |
| A0A1Y3EUN0 | 19-421 | None |
| A0A453BDM3 | 1-364 | None |
| A0A194RH31 | 215-633 | None |
| A0A5B6YSK6 | 102-544 | None |
| A0A0C2IKK5 | 2-302 | None |
| A0A507EVQ5 | 184-615 | None |
| A0A1E2Y509 | 221-752 | None |
| A0A284R9R7 | 171-603 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.