DPCstruct | MC55824
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 195 ± 19 aa |
| Standard deviation of domain lengths | 18.67 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 70.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A505I005 | 7-202 | QGYAIRRNNSCLSDEVGCGRTWETWHACCPSGSKCPGKEYSIQNNVCCPTWTDCTSEIKPAVCANSTWNMYDYDGYFCCTQDESGFR… |
| A0A1Y2LHG8 | 39-244 | GGFALRTPRSSCPAGSKSCKGGYATRCCPSNTECIITDTAYCCKDGDCSASLIDSPRCPVADWSLWSTAKTIDFDNTWCCETGLFGI… |
| A0A6A5RGQ3 | 41-222 | None |
| A0A0A2L646 | 1-160 | None |
| A0A135T786 | 12-209 | None |
| A0A132B1T2 | 20-228 | None |
| A0A2J6TAT0 | 15-217 | None |
| A0A4S2MQB7 | 40-249 | None |
| A0A3N4LYH5 | 39-236 | None |
| A0A1R3RZF3 | 3-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.