DPCstruct | MC55822
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 68 ± 4 aa |
| Standard deviation of domain lengths | 4.05 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 29.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G2FT15 | 1-66 | MLVYKYIEKNPIIKIPSVANELGYSFNTVAKVVEAMVGCGILKQANNQSRHRHFIYEDYVKIFDMV |
| T0YZM9 | 81-145 | AVDLLLRLLVGAPVITVNSIADLIGVSFVHTNEAITRLVDAGILKQVTVGRRNRAFEAPEIIEAF |
| A0A3B0B960 | 138-208 | None |
| A0A143XBA3 | 9-71 | None |
| A0A3C0CSC8 | 1-74 | None |
| A0A2M8CF52 | 8-71 | None |
| A0A3N0AX17 | 105-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.