DPCstruct | MC5582
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 133 ± 16 aa |
| Standard deviation of domain lengths | 15.61 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G4A8R5 | 1-120 | MSAASAKDAQKEADRIEPVLKRLWGQKKWDPKSVRAALLELGYEEERTGPKGERLGGTLTVRKMYPRYETDHNVTPEGALIGLRVHD… |
| A0A2T5WD40 | 6-132 | PSGYVGDLPGDMPPNYAANHAFQRRMRLCGDDLTHAAAEGARLREALGGLEPRTVETVQRALVGLGHDPRSMTVTPGASGVTFVLEA… |
| A0A7X0GS87 | 201-358 | None |
| A0A1N6B312 | 104-241 | None |
| A0A2Z5JHS7 | 26-175 | None |
| A0A160NYG2 | 37-158 | None |
| A0A7K2ZV14 | 5-135 | None |
| A0A4S2TIG7 | 21-152 | None |
| A0A542U6H5 | 199-344 | None |
| A0A1R1SQ83 | 11-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.