DPCstruct | MC55817
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 237 ± 43 aa |
| Standard deviation of domain lengths | 42.74 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 66.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E4SH39 | 1-163 | MARDDSASATGPVASEPVLGAKTASSWTSGSSASSTPMSSPNMSNTSLAAKDDKSPKRRQRLGPSCDSCRSRKVKCNAVISIVAKAF… |
| A0A1V2LBH5 | 2-195 | SMNNLVNIQPAPPTQSTSPKLGKQMSKSTPIVVSTPTVTLAPGPTPGPTSRSKPSKITKPQGRPHTRPRSRKVQQHITGKSSRQRVG… |
| A0A376B4B8 | 68-349 | None |
| A0A1G4M884 | 38-327 | None |
| A0A1L0CNF2 | 147-456 | None |
| A0A4P9ZH13 | 6-241 | None |
| A0A1E3P5R0 | 53-248 | None |
| A0A642V015 | 34-276 | None |
| A0A1D8PNM7 | 128-347 | None |
| A0A061AK60 | 185-395 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.