DPCstruct | MC55807
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 89 ± 5 aa |
| Standard deviation of domain lengths | 5.08 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 36.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3G8RB30 | 1-83 | MLDICIFDLTPLPILIHDSVLFKNVENSVVDNIIELYDEQRKQTFISIDELNKYSSTTQEILFTHSVIQLSKDKLLFDKDWRA |
| A0A1I0AVA9 | 40-126 | FKSLVIYDLTILELRPIPALIHDSNILKRIEDIHLEHILERYQSSNRQVFIAFDKADSTTEKAHKILEETAILRLSDGNELFGRSWS |
| A0A174ZJP3 | 3-89 | None |
| A0A370NGA7 | 47-148 | None |
| A0A7X7C2D3 | 6-92 | None |
| A0A0R1PEL8 | 140-226 | None |
| A0A416FG17 | 230-316 | None |
| R5YKC9 | 298-393 | None |
| A0A7T3V4V0 | 306-393 | None |
| A0A2I1KTE5 | 326-411 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.